Allergen

A4GFC3.1

Accession A4GFC3.1
External DB Link NCBI Protein
Species Olea europaea
Common Name olive
Description profilin
IUIS Name Ole e 2
Length 131
Year Adopted 2015
Sequence >A4GFC3.1 Ole e 2; profilin [Olea europaea]
MSWQAYVYEHLMCEIESHHLSSAAILGHDGTVWAQSTAFPQFKPEEITGIMKDFDEPGHL
APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE
RLGDYLLEQGQ
Parent Accession

Related Articles

Pubmed Authors Title Journal
9314349 Asturias,J.A.; Arilla,M.C.; Gomez-Bayon,N.; Martinez,J.; Martinez,A.; Palacios,R. Cloning and expression of the panallergen profilin and the major allergen (Ole e 1) from olive tree pollen J. Allergy Clin. Immunol. 100 (3), 365-372 (1997)
15679723 Quiralte J; Llanes E; Barral P; Arias de Saavedra JM; Saenz de San Pedro B; Villalba M; Florido JF; Rodriguez R; Lahoz C; Cardaba B Ole e 2 and Ole e 10: new clinical aspects and genetic restrictions in olive pollen allergy. Allergy. 2005 Mar;60(3):360-5