Allergen

A5HII1.1

Accession A5HII1.1
External DB Link NCBI Protein
Species Actinidia deliciosa
Common Name green kiwifruit
Description actinidin
IUIS Name Act d 1
Length 380
Year Adopted 2012
Sequence >A5HII1.1 Act d 1; actinidin [Actinidia deliciosa]
MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYGKSYNSLGEWE
RRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFRSTYLGFTSGSNKTKVSNRYE
PRVGQVLPSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELI
DCGRTQNTRGCNGGYITDGFQFIINNGGINTEENYPYTAQDGECNLDLQNEKYVTIDTYE
NVPYNNEWALQTAVTYQPVSVALDAAGDAFKHYSSGIFTGPCGTAIDHAVTIVGYGTEGG
IDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYNNQNHPKPYSSLINPP
AFSMSKDGPVGVDDGQRYSA
Parent Accession

Related Articles

Pubmed Authors Title Journal
15536427 Bublin M; Mari A; Ebner C; Knulst A; Scheiner O; Hoffmann-Sommergruber K; Breiteneder H; Radauer C IgE sensitization profiles toward green and gold kiwifruits differ among patients allergic to kiwifruit from 3 European countries. J Allergy Clin Immunol. 2004 Nov;114(5):1169-75
15482522 Fiocchi A; Restani P; Bernardo L; Martelli A; Ballabio C; D Tolerance of heat-treated kiwi by children with kiwifruit allergy. Pediatr Allergy Immunol. 2004 Oct;15(5):454-8
8828538 Pastorello EA; Pravettoni V; Ispano M; Farioli L; Ansaloni R; Rotondo F; Incorvaia C; Asman I; Bengtsson A; Ortolani C Identification of the allergenic components of kiwi fruit and evaluation of their cross-reactivity with timothy and birch pollens. J Allergy Clin Immunol. 1996 Sep;98(3):601-10
18655003 Bublin M; Radauer C; Knulst A; Wagner S; Scheiner O; Mackie AR; Mills EN; Breiteneder H Effects of gastrointestinal digestion and heating on the allergenicity of the kiwi allergens Act d 1, actinidin, and Act d 2, a thaumatin-like protein. Mol Nutr Food Res. 2008 Oct;52(10):1130-9
20061012 Bublin M; Pfister M; Radauer C; Oberhuber C; Bulley S; Dewitt AM; Lidholm J; Reese G; Vieths S; Breiteneder H; Hoffmann-Sommergruber K; Ballmer-Weber BK Component-resolved diagnosis of kiwifruit allergy with purified natural and recombinant kiwifruit allergens. J Allergy Clin Immunol. 2010 Mar;125(3):687-94, 694.e1
20825426 Bernardi ML; Picone D; Tuppo L; Giangrieco I; Petrella G; Palazzo P; Ferrara R; Tamburrini M; Mari A; Ciardiello MA Physico-chemical features of the environment affect the protein conformation and the immunoglobulin E reactivity of kiwellin (Act d 5). Clin Exp Allergy. 2010 Dec;40(12):1819-26
23141741 Le TM; Bublin M; Breiteneder H; Fernández-Rivas M; Asero R; Ballmer-Weber B; Barreales L; Bures P; Belohlavkova S; de Blay F; Clausen M; Dubakiene R; Gislason D; van Hoffen E; Jedrzejczak-Czechowicz M; Kowalski ML; Kralimarkova T; Lidholm J; DeWitt AM; Mills CE; Papadopoulos NG; Popov T; Purohit A; van Ree R; Seneviratne S; Sinaniotis A; Summers C; Vázquez-Cortés S; Vieths S; Vogel L; Hoffmann-Sommergruber K; Knulst AC Kiwifruit allergy across Europe: clinical manifestation and IgE recognition patterns to kiwifruit allergens. J Allergy Clin Immunol. 2013 Jan;131(1):164-71