Allergen

AAA16522.1

Accession AAA16522.1
External DB Link NCBI Protein
Species Betula pendula
Common Name European white birch
Description profilin
IUIS Name Bet v 2
Length 133
Year Adopted 2011
Sequence >AAA16522.1 Bet v 2; profilin [Betula pendula]
MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG
HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV
VERLGDYLIDQGL
Parent Accession

Related Articles

Pubmed Authors Title Journal
1857985 Valenta,R.; Duchene,M.; Pettenburger,K.; Sillaber,C.; Valent,P.; Bettelheim,P.; Breitenbach,M.; Rumpold,H.; Kraft,D.; Scheiner,O. Identification of profilin as a novel pollen allergen; IgE autoreactivity in sensitized individuals Science 253 (5019), 557-560 (1991)
9016715 Fedorov,A.A.; Ball,T.; Mahoney,N.M.; Valenta,R.; Almo,S.C. The molecular basis for allergen cross-reactivity: crystal structure and IgE-epitope mapping of birch pollen profilin Structure 5 (1), 33-45 (1997)
9130496 Fedorov,A.A.; Ball,T.; Valenta,R.; Almo,S.C. X-ray crystal structures of birch pollen profilin and Phl p 2 Int. Arch. Allergy Immunol. 113 (1-3), 109-113 (1997)
12911423 Rossi RE; Monasterolo G; Monasterolo S Detection of specific IgE antibodies in the sera of patients allergic to birch pollen using recombinant allergens Bet v 1, Bet v 2, Bet v 4: evaluation of different IgE reactivity profiles. Allergy. 2003 Sep;58(9):929-32
12218371 Moverare R; Westritschnig K; Svensson M; Hayek B; Bende M; Pauli G; Sorva R; Haahtela T; Valenta R; Elfman L Different IgE reactivity profiles in birch pollen-sensitive patients from six European populations revealed by recombinant allergens: an imprint of local sensitization. Int Arch Allergy Immunol. 2002 Aug;128(4):325-35
7678614 Valenta R; Sperr WR; Ferreira F; Valent P; Sillaber C; Tejkl M; Duchene M; Ebner C; Lechner K; Kraft D Induction of specific histamine release from basophils with purified natural and recombinant birch pollen allergens. J Allergy Clin Immunol. 1993 Jan;91(1 Pt 1):88-97