Allergen

AAA20066.1

Accession AAA20066.1
External DB Link NCBI Protein
Species Ambrosia psilostachya
Common Name Western ragweed
Description unknown function
IUIS Name Amb p 5
Length 77
Year Adopted 2007
Sequence >AAA20066.1 Amb p 5; unknown function [Ambrosia psilostachya]
MNNEKNVSFEFIGSTNEVDEIKVMACYAAGSICGEKRGYSSSDPGRYCPWQVVCYESRKI
CAKNAAKMRMNVTKNTI
Parent Accession

Related Articles

Pubmed Authors Title Journal
7511632 Ghosh,B.; Rafnar,T.; Perry,M.P.; Bassolino-Klimas,D.; Metzler,W.J.; Klapper,D.G.; Marsh,D.G. Immunologic and molecular characterization of Amb p V allergens from Ambrosia psilostachya (western Ragweed) pollen J. Immunol. 152 (6), 2882-2889 (1994)
1122277 Mole,L.E.; Goodfriend,L.; Lapkoff,C.B.; Kehoe,J.M.; Capra,J.D. The amino acid sequence of ragweed pollen allergen Ra5 Biochemistry 14 (6), 1216-1220 (1975)
4685040 Marsh DG; Bias WB; Hsu SH; Goodfriend L Association of the HL-A7 cross-reacting group with a specific reaginic antibody response in allergic man. Science. 1973 Feb 16;179(74):691-3