Allergen

AAA41198.1

Accession AAA41198.1
External DB Link NCBI Protein
Species Rattus norvegicus
Common Name rat
Description lipocalin, urinary globulin
IUIS Name Rat n 1
Length 177
Year Adopted 2015
Sequence >AAA41198.1 Rat n 1; lipocalin, urinary globulin [Rattus norvegicus]
LLLLCLGLTLVCGHAEEASSTSGNLDVAKLNGDWFSIVVASNKREKIEENGSMRVFMQHI
DVLENSLGFKFRIKENGECRELYLVAYKTPEDGEYFVEYDGGNTFTILKTDYDRYVMFHL
INFKNGETFQLMVLYGRTKDLSSDIKEKFAKLCEAHGITRDNIIDLTKTDRCLQARG
Parent Accession

Related Articles

Pubmed Authors Title Journal
10574630 Bayard C; Siddique AB; Berzins K; Troye-Blomberg M; Hellman U; Vesterberg O Mapping of IgE binding regions in the major rat urinary protein, alpha 2u-globulin, using overlapping peptides. Immunol Invest. 1999 Sep-Dec;28(5-6):323-38
3819230 Platts-Mills TA; Longbottom J; Edwards J; Cockroft A; Wilkins S Occupational asthma and rhinitis related to laboratory rats: serum IgG and IgE antibodies to the rat urinary allergen. J Allergy Clin Immunol. 1987 Mar;79(3):505-15
12372120 Lieutier-Colas F; Meyer P; Pons F; Hedelin G; Larsson P; Malmberg P; Pauli G; De Blay F Prevalence of symptoms, sensitization to rats, and airborne exposure to major rat allergen (Rat n 1) and to endotoxin in rat-exposed workers: a cross-sectional study. Clin Exp Allergy. 2002 Oct;32(10):1424-9