Allergen

AAB07620.1

Accession AAB07620.1
External DB Link NCBI Protein
Species Aspergillus fumigatus
Common Name fungus
Description unknown function, partial
IUIS Name Asp f 2
Length 250
Year Adopted 2007
Sequence >AAB07620.1 Asp f 2; unknown function, partial [Aspergillus fumigatus]
SARDEAGLNEAVELARHAKAHILRWGNESEIYRKYFGNRPTMEAVGAYDVIVNGDKANVL
FRCDNPDGNCALEGWGGHWRGANATSETVICDRSYTTRRWLVSMCSQGYTVAGSETNTFW
ASDLMHRLYHVPAVGQGWVDHFADGYDEVIALAKSNGTESTHDSEAFEYFALEAYAFDIA
APGVGCAGESHGPDQGHDTGSASAPASTSTSSSSSGSGSGATTTPTDSPSATIDVPSNCH
THEGGQLHCT
Parent Accession

Related Articles

Pubmed Authors Title Journal
9784519 Banerjee,B.; Greenberger,P.A.; Fink,J.N.; Kurup,V.P. Immunological characterization of Asp f 2, a major allergen from Aspergillus fumigatus associated with allergic bronchopulmonary aspergillosis Infect. Immun. 66 (11), 5175-5182 (1998)
10848921 Kurup VP; Banerjee B; Hemmann S; Greenberger PA; Blaser K; Crameri R Selected recombinant Aspergillus fumigatus allergens bind specifically to IgE in ABPA. Clin Exp Allergy. 2000 Jul;30(7):988-93
16859543 Kurup VP; Knutsen AP; Moss RB; Bansal NK Specific antibodies to recombinant allergens of Aspergillus fumigatus in cystic fibrosis patients with ABPA. Clin Mol Allergy. 2006 Jul 21;4:11
14763934 Knutsen AP; Hutcheson PS; Slavin RG; Kurup VP IgE antibody to Aspergillus fumigatus recombinant allergens in cystic fibrosis patients with allergic bronchopulmonary aspergillosis. Allergy. 2004 Feb;59(2):198-203