Allergen

AAB32652.2

Accession AAB32652.2
External DB Link NCBI Protein
Species Olea europaea
Common Name olive
Description Ole e 1-like
IUIS Name Ole e 1
Length 130
Year Adopted 2007
Sequence >AAB32652.2 Ole e 1; Ole e 1-like [Olea europaea]
QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN
EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY
NKLGMYPPNM
Parent Accession

Related Articles

Pubmed Authors Title Journal
9314349 Asturias,J.A.; Arilla,M.C.; Gomez-Bayon,N.; Martinez,J.; Martinez,A.; Palacios,R. Cloning and expression of the panallergen profilin and the major allergen (Ole e 1) from olive tree pollen J. Allergy Clin. Immunol. 100 (3), 365-372 (1997)
15941589 Gonzalez EM; Villalba M; Quiralte J; Batanero E; Roncal F; Albar JP; Rodriguez R Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen. Mol Immunol. 2006 Feb;43(6):570-8
12213332 Gonzalez EM; Villalba M; Lombardero M; Aalbers M; van Ree R; Rodriguez R Influence of the 3D-conformation, glycan component and microheterogeneity on the epitope structure of Ole e 1, the major olive allergen. Use of recombinant isoforms and specific monoclonal antibodies as immunological tools. Mol Immunol. 2002 Sep;39(1-2):93-101
10878488 Quiralte J; Gonzalez E; Arias De Saavedra JM; Villalba M; Florido JF; Saenz De San Pedro B; Rodriguez R Immunological activity of recombinant Ole e 1 in patients with Olea europaea pollinosis. Int Arch Allergy Immunol. 2000 Jun;122(2):101-7