Allergen

AAB60215.1

Accession AAB60215.1
External DB Link NCBI Protein
Species Dermatophagoides pteronyssinus
Common Name house dust mite
Description cysteine protease
IUIS Name Der p 1
Length 320
Year Adopted 2012
Sequence >AAB60215.1 Der p 1; cysteine protease [Dermatophagoides pteronyssinus]
MKIVLAIASLLALSAVYARPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSN
GGAINHLSDLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTV
TPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHGCHGDTIPRGIEY
IQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIYPPNVNKIREALAQTHSAIAVII
GIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYG
YFAANIDLMMIEEYPYVVIL
Parent Accession

Related Articles

Pubmed Authors Title Journal
3276629 Thomas,W.R.; Stewart,G.A.; Simpson,R.J.; Chua,K.Y.; Plozza,T.M.; Dilworth,R.J.; Nisbet,A.; Turner,K.J. Cloning and expression of DNA coding for the major house dust mite allergen Der p 1 in Escherichia coli Int. Arch. Allergy Appl. Immunol. 85 (1), 127-129 (1988)
2021874 Dilworth,R.J.; Chua,K.Y.; Thomas,W.R. Sequence analysis of cDNA coding for a major house dust mite allergen, Der f I Clin. Exp. Allergy 21 (1), 25-32 (1991)
3372999 Lind,P.; Hansen,O.C.; Horn,N. The binding of mouse hybridoma and human IgE antibodies to the major fecal allergen, Der p I, of Dermatophagoides pteronyssinus. Relative binding site location and species specificity studied by solid-phase inhibition assays with radiolabeled antigen J. Immunol. 140 (12), 4256-4262 (1988)
12372994 Thomas WR; Smith WA; Hales BJ; Mills KL; O Characterization and immunobiology of house dust mite allergens. Int Arch Allergy Immunol. 2002 Sep;129(1):1-18
15867862 Erwin EA; Custis NJ; Satinover SM; Perzanowski MS; Woodfolk JA; Crane J; Wickens K; Platts-Mills TA Quantitative measurement of IgE antibodies to purified allergens using streptavidin linked to a high-capacity solid phase. J Allergy Clin Immunol. 2005 May;115(5):1029-35
16148130 Meno,K.; Thorsted,P.B.; Ipsen,H.; Kristensen,O.; Larsen,J.N.; Spangfort,M.D.; Gajhede,M.; Lund,K.; The crystal structure of recombinant proDer p 1, a major house dust mite proteolytic allergen J. Immunol. 175 (6), 3835-3845 (2005)
17505140 Liu,Z.; Bai,Y.; Ji,K.; Liu,X.; Cai,C.; Yu,H.; Li,M.; Bao,Y.; Lian,Y.; Gao,B.; Detection of Dermatophagoides farinae in the Dust of Air Conditioning Filters (er) Int. Arch. Allergy Immunol. 144 (1), 85-90 (2006)
18220991 Thomas WR; Heinrich TK; Smith WA; Hales BJ Pyroglyphid house dust mite allergens. Protein Pept Lett. 2007;14(10):943-53