Allergen

AAB60779.1

Accession AAB60779.1
External DB Link NCBI Protein
Species Aspergillus fumigatus
Common Name fungus
Description superoxide dismutase
IUIS Name Asp f 6
Length 221
Year Adopted 2007
Sequence >AAB60779.1 Asp f 6; superoxide dismutase [Aspergillus fumigatus]
GTSPIQTPINTMSQQYTLPPLPYPYDALQPYISQQIMELHHKKHHQTYVNGLNAALEAQK
KAAEATDVPKLVSVQQAIKFNGGGHINHSLFWKNLAPEKSGGGKIDQAPVLKAAIEQRWG
SFDKFKDAFNTTLLGIQGSGWGWLVTDGPKGKLDITTTHDQDPVTGAAPVFGVDMWEHAY
YLQYLNDKASYAKGIWNVINWAEAENRYIAGDKGGHPFMKL
Parent Accession

Related Articles

Pubmed Authors Title Journal
8691141 Crameri,R.; Faith,A.; Hemmann,S.; Jaussi,R.; Ismail,C.; Menz,G.; Blaser,K. Humoral and cell-mediated autoimmunity in allergy to Aspergillus fumigatus J. Exp. Med. 184 (1), 265-270 (1996)
9565354 Hemmann S; Nikolaizik WH; Schoni MH; Blaser K; Crameri R Differential IgE recognition of recombinant Aspergillus fumigatus allergens by cystic fibrosis patients with allergic bronchopulmonary aspergillosis or Aspergillus allergy. Eur J Immunol. 1998 Apr;28(4):1155-60
16197477 Schwienbacher M; Israel L; Heesemann J; Ebel F Asp f6, an Aspergillus allergen specifically recognized by IgE from patients with allergic bronchopulmonary aspergillosis, is differentially expressed during germination. Allergy. 2005 Nov;60(11):1430-5
12218367 Fluckiger S; Scapozza L; Mayer C; Blaser K; Folkers G; Crameri R Immunological and structural analysis of IgE-mediated cross-reactivity between manganese superoxide dismutases. Int Arch Allergy Immunol. 2002 Aug;128(4):292-303
10482834 Hemmann S; Menz G; Ismail C; Blaser K; Crameri R Skin test reactivity to 2 recombinant Aspergillus fumigatus allergens in A fumigatus-sensitized asthmatic subjects allows diagnostic separation of allergic bronchopulmonary aspergillosis from fungal sensitization. J Allergy Clin Immunol. 1999 Sep;104(3 Pt 1):601-7