Allergen

AAB93837.1

Accession AAB93837.1
External DB Link NCBI Protein
Species Ascaris lumbricoides
Common Name parasitic roundworm
Description unknown function
IUIS Name
Length 134
Year Adopted 2007
Sequence >AAB93837.1 unknown function [Ascaris lumbricoides]
HTMEHYLKTYLSWLTEEQKEKLKEMKEAGKTKAEIQHEVMRYYDQLHGEEKQQATEKLKV
GCKMLLKGIIGEEKVVELRNMKEAGADIQELRQKVEKMLSEVTDEKQKEKVHEYGPACKK
IFGATTLQHHRRRR
Parent Accession

Related Articles

Pubmed Authors Title Journal
9916049 McSharry,C.; Xia,Y.; Holland,C.V.; Kennedy,M.W. Natural immunity to Ascaris lumbricoides associated with immunoglobulin E antibody to ABA-1 allergen and inflammation indicators in children Infect. Immun. 67 (2), 484-489 (1999)
7682160 Christie,J.F.; Dunbar,B.; Kennedy,M.W. The ABA-1 allergen of the nematode Ascaris suum: epitope stability, mass spectrometry, and N-terminal sequence comparison with its homologue in Toxocara canis Clin. Exp. Immunol. 92 (1), 125-132 (1993)
2335378 Christie JF; Dunbar B; Davidson I; Kennedy MW N-terminal amino acid sequence identity between a major allergen of Ascaris lumbricoides and Ascaris suum, and MHC-restricted IgE responses to it. Immunology. 1990 Apr;69(4):596-602
12379682 Paterson JC; Garside P; Kennedy MW; Lawrence CE Modulation of a heterologous immune response by the products of Ascaris suum. Infect Immun. 2002 Nov;70(11):6058-67