Allergen

AAB95638.1

Accession AAB95638.1
External DB Link NCBI Protein
Species Aspergillus fumigatus
Common Name fungus
Description peroxisomal protein
IUIS Name Asp f 3
Length 168
Year Adopted 2007
Sequence >AAB95638.1 Asp f 3; peroxisomal protein [Aspergillus fumigatus]
MSGLKAGDSFPSDVVFSYIPWSEDKGEITACGIPINYNASKEWADKKVILFALPGAFTPV
CSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQVTGDDILFLSDPDARFS
KSIGWADEEGRTKRYALVIDHGKITYAALEPAKNHLEFSSAETVLKHL
Parent Accession

Related Articles

Pubmed Authors Title Journal
9412580 Hemmann,S.; Blaser,K.; Crameri,R. Allergens of Aspergillus fumigatus and Candida boidinii share IgE-binding epitopes Am. J. Respir. Crit. Care Med. 156 (6), 1956-1962 (1997)
9720820 Hemmann S; Ismail C; Blaser K; Menz G; Crameri R Skin-test reactivity and isotype-specific immune responses to recombinant Asp f 3, a major allergen of Aspergillus fumigatus. Clin Exp Allergy. 1998 Jul;28(7):860-7
10848921 Kurup VP; Banerjee B; Hemmann S; Greenberger PA; Blaser K; Crameri R Selected recombinant Aspergillus fumigatus allergens bind specifically to IgE in ABPA. Clin Exp Allergy. 2000 Jul;30(7):988-93
14763934 Knutsen AP; Hutcheson PS; Slavin RG; Kurup VP IgE antibody to Aspergillus fumigatus recombinant allergens in cystic fibrosis patients with allergic bronchopulmonary aspergillosis. Allergy. 2004 Feb;59(2):198-203