Allergen

AAC02632.1

Accession AAC02632.1
External DB Link NCBI Protein
Species Prunus avium
Common Name cherry
Description pathogenesis related protein, PR-10, Bet v 1-like
IUIS Name Pru av 1
Length 160
Year Adopted 2007
Sequence >AAC02632.1 Pru av 1; pathogenesis related protein, PR-10, Bet v 1-like [Prunus avium]
MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG
EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH
YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN
Parent Accession

Related Articles

Pubmed Authors Title Journal
11295665 Scheurer,S.; Pastorello,E.A.; Wangorsch,A.; Kastner,M.; Haustein,D.; Vieths,S. Recombinant allergens Pru av 1 and Pru av 4 and a newly identified lipid transfer protein in the in vitro diagnosis of cherry allergy J. Allergy Clin. Immunol. 107 (4), 724-731 (2001)
15330760 Wiche R; Gubesch M; Konig H; Fotisch K; Hoffmann A; Wangorsch A; Scheurer S; Vieths S Molecular basis of pollen-related food allergy: identification of a second cross-reactive IgE epitope on Pru av 1, the major cherry (Prunus avium) allergen. Biochem J. 2005 Jan 1;385(Pt 1):319-27
16199263 Mittag D; Batori V; Neudecker P; Wiche R; Friis EP; Ballmer-Weber BK; Vieths S; Roggen EL A novel approach for investigation of specific and cross-reactive IgE epitopes on Bet v 1 and homologous food allergens in individual patients. Mol Immunol. 2006 Feb;43(3):268-78
9393965 Scheurer S; Metzner K; Haustein D; Vieths S Molecular cloning, expression and characterization of Pru a 1, the major cherry allergen. Mol Immunol. 1997 Jun;34(8-9):619-29