Allergen

AAC80579.1

Accession AAC80579.1
External DB Link NCBI Protein
Species Blomia tropicalis
Common Name house dust mite
Description fatty acid-binding protein
IUIS Name Blo t 13
Length 130
Year Adopted 2007
Sequence >AAC80579.1 Blo t 13; fatty acid-binding protein [Blomia tropicalis]
MPIEGKYKLEKSDNFDKFLDELGVGFMVKTAAKTLKPTLEVDVQGDTYVFRSLSTFKNTE
IKFKLGEEFEEDRADGKRVKTVVNKEGDNKFIQTQYGDKEVKIVRDFQGDDVVVTASVGD
VTSVRTYKRI
Parent Accession

Related Articles

Pubmed Authors Title Journal
9104789 Caraballo,L.; Puerta,L.; Jimenez,S.; Martinez,B.; Mercado,D.; Avjiouglu,A.; Marsh,D. Cloning and IgE binding of a recombinant allergen from the mite Blomia tropicalis, homologous with fatty acid-binding proteins Int. Arch. Allergy Immunol. 112 (4), 341-347 (1997)
17504089 Chua KY; Cheong N; Kuo IC; Lee BW; Yi FC; Huang CH; Liew LN The Blomia tropicalis allergens. Protein Pept Lett. 2007;14(4):325-33