Allergen

AAC82352.1

Accession AAC82352.1
External DB Link NCBI Protein
Species Euroglyphus maynei
Common Name house dust mite
Description cysteine protease
IUIS Name Eur m 1
Length 327
Year Adopted 2007
Sequence >AAC82352.1 Eur m 1; cysteine protease [Euroglyphus maynei]
KHLSTIMKIILAIASLLVLSAVYARPASIKTFEEFKKAFNKSYATPEKEEVARKNFLESL
KYVESNKGAINHLSDLSLDEFKNQFLMNANAFEQLKTQFDLNAETYACSINSVSLPSELD
LRSLRTVTPIRNQGGCGSCWAFSGVASTESAYLAYRNMSLDLAEQELVDCASQNGCHGDT
IPRGIEYIQQNGVVQEHYYPYVAREQSCHRPNAQRYGLKNYCQISPPDSNKIRQALTQTH
TAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNYHAVNIVGYGNTQGVDYWIVRNSWDTT
WGDNGYGYFAANINLMMIEQYPYVVIL
Parent Accession

Related Articles

Pubmed Authors Title Journal
9925958 Smith,W.; Mills,K.; Hazell,L.; Hart,B.; Thomas,W. Molecular analysis of the group 1 and 2 allergens from the house dust mite, Euroglyphus maynei Int. Arch. Allergy Immunol. 118 (1), 15-22 (1999)
2044430 Arlian LG House-dust-mite allergens: a review. Exp Appl Acarol. 1991 Feb;10(3-4):167-86
8491937 Arlian LG; Rapp CM; Fernandez-Caldas E Allergenicity of Euroglyphus maynei and its cross-reactivity with Dermatophagoides species. J Allergy Clin Immunol. 1993 May;91(5):1051-8
8933777 Morgan MS; Arlian LG; Fernandez-Caldas E Cross-allergenicity of the house dust mites Euroglyphus maynei and Blomia tropicalis. Ann Allergy Asthma Immunol. 1996 Nov;77(5):386-92
9827424 Garcia-Robaina JC; Eraso E; De la Torre F; Guisantes J; Martinez A; Palacios R; Martinez J Extracts from various mite species contain cross-reactive and noncross-reactive IgE epitopes. A RAST inhibition study. J Investig Allergol Clin Immunol. 1998 Sep-Oct;8(5):285-9
22210776 Chruszcz,M.; Pomes,A.; Glesner,J.; Vailes,L.D.; Osinski,T.; Porebski,P.J.; Majorek,K.A.; Heymann,P.W.; Platts-Mills,T.A.; Minor,W.; Chapman,M.D.; Molecular determinants for antibody binding on group 1 house dust mite allergens J. Biol. Chem. 287 (10), 7388-7398 (2012)
23427664 Morales M; Iraola V; Leonor JR; Carnés J Enzymatic activity of allergenic house dust and storage mite extracts. J Med Entomol. 2013 Jan;50(1):147-54
20605742 Thomas WR; Hales BJ; Smith WA House dust mite allergens in asthma and allergy. Trends Mol Med. 2010 Jul;16(7):321-8
24925403 Fernández-Caldas E; Puerta L; Caraballo L Mites and allergy. Chem Immunol Allergy. 2014;100:234-42