Allergen

AAD47382.1

Accession AAD47382.1
External DB Link NCBI Protein
Species Arachis hypogaea
Common Name peanut
Description 11S globulin, cupin
IUIS Name Ara h 3
Length 530
Year Adopted 2007
Sequence >AAD47382.1 Ara h 3; 11S globulin, cupin [Arachis hypogaea]
MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNN
QEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGR
RYQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLT
DTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFR
PRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVT
VRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEETICTACVKKNI
GGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYAL
RGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANF
AGENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA
Parent Accession

Related Articles

Pubmed Authors Title Journal
10021462 Rabjohn,P.; Helm,E.M.; Stanley,J.S.; West,C.M.; Sampson,H.A.; Burks,A.W.; Bannon,G.A. Molecular cloning and epitope analysis of the peanut allergen Ara h 3 J. Clin. Invest. 103 (4), 535-542 (1999)
10474031 Kleber-Janke,T.; Crameri,R.; Appenzeller,U.; Schlaak,M.; Becker,W.M. Selective cloning of peanut allergens, including profilin and 2S albumins, by phage display technology Int. Arch. Allergy Immunol. 119 (4), 265-274 (1999)
14995153 Dodo,H.W.; Viquez,O.M.; Maleki,S.J.; Konan,K.N.; cDNA clone of a putative peanut (Arachis hypogaea L.) trypsin inhibitor has homology with peanut allergens Ara h 3 and Ara h 4 J. Agric. Food Chem. 52 (5), 1404-1409 (2004)
15765743 Restani P; Ballabio C; Corsini E; Fiocchi A; Isoardi P; Magni C; Poiesi C; Terracciano L; Duranti M Identification of the basic subunit of Ara h 3 as the major allergen in a group of children allergic to peanuts. Ann Allergy Asthma Immunol. 2005 Feb;94(2):262-6
15080811 Koppelman SJ; Wensing M; Ertmann M; Knulst AC; Knol EF Relevance of Ara h1, Ara h2 and Ara h3 in peanut-allergic patients, as determined by immunoglobulin E Western blotting, basophil-histamine release and intracutaneous testing: Ara h2 is the most important peanut allergen. Clin Exp Allergy. 2004 Apr;34(4):583-90
21305299 Jiang S; Wang S; Sun Y; Zhou Z; Wang G Molecular characterization of major allergens Ara h 1, 2, 3 in peanut seed. Plant Cell Rep. 2011 Jun;30(6):1135-43