Allergen

AAD52616.1

Accession AAD52616.1
External DB Link NCBI Protein
Species Polistes annularis
Common Name paper wasp
Description hyaluronidase
IUIS Name Pol a 2
Length 367
Year Adopted 2011
Sequence >AAD52616.1 Pol a 2; hyaluronidase [Polistes annularis]
YVSLSPDSVFNIITDDISHQILSRSNCERSKRPKRVFSIYWNVPTFMCHQYGMNFDEVTD
FNIKHNSKDNFRGETISIYYDPGKFPALMPLKNGNYEERNGGVPQRGNITIHLQQFNEDL
DKMTPDKNFGGIGVIDFERWKPIFRQNWGNTEIHKKYSIELVRKEHPKWSESMIEAEATK
KFEKYARYFMEETLKLAKKTRKRAKWGYYGFPYCYNVTPNNPGPDCDAKATIENDRLSWM
YNNQEILFPSVYVRHEQKPEERVYLVQGRIKEAVRISNNLEHSPSVLAYWWYVYQDKMDI
YLSETDVEKTFQEIVTNGGDGIIIWGSSSDVNSLSKCKRLREYLLNTLGPFAVNVTETVN
GRSSLNF
Parent Accession

Related Articles

Pubmed Authors Title Journal
8828537 King,T.P.; Lu,G.; Gonzalez,M.; Qian,N.; Soldatova,L. Yellow jacket venom allergens, hyaluronidase and phospholipase: sequence similarity and antigenic cross-reactivity with their hornet and wasp homologs and possible implications for clinical allergy J. Allergy Clin. Immunol. 98 (3), 588-600 (1996)
14572904 Pantera,B.; Hoffman,D.R.; Carresi,L.; Cappugi,G.; Turillazzi,S.; Manao,G.; Severino,M.; Spadolini,I.; Orsomando,G.; Moneti,G.; Pazzagli,L.; Characterization of the major allergens purified from the venom of the paper wasp Polistes gallicus Biochim. Biophys. Acta 1623 (2-3), 72-81 (2003)
3989146 Hoffman DR Allergens in Hymenoptera venom XIV: IgE binding activities of venom proteins from three species of vespids. J Allergy Clin Immunol. 1985 May;75(5):606-10
16218950 Kolarich D; Leonard R; Hemmer W; Altmann F The N-glycans of yellow jacket venom hyaluronidases and the protein sequence of its major isoform in Vespula vulgaris. FEBS J. 2005 Oct;272(20):5182-90
15005742 Hemmer W; Focke M; Kolarich D; Dalik I; Gotz M; Jarisch R Identification by immunoblot of venom glycoproteins displaying immunoglobulin E-binding N-glycans as cross-reactive allergens in honeybee and yellow jacket venom. Clin Exp Allergy. 2004 Mar;34(3):460-9