Allergen

AAD55587.1

Accession AAD55587.1
External DB Link NCBI Protein
Species Arachis hypogaea
Common Name peanut
Description profilin
IUIS Name Ara h 5
Length 131
Year Adopted 2007
Sequence >AAD55587.1 Ara h 5; profilin [Arachis hypogaea]
MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL
APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE
RLGDYLIDTGL
Parent Accession

Related Articles

Pubmed Authors Title Journal
10474031 Kleber-Janke,T.; Crameri,R.; Appenzeller,U.; Schlaak,M.; Becker,W.M. Selective cloning of peanut allergens, including profilin and 2S albumins, by phage display technology Int. Arch. Allergy Immunol. 119 (4), 265-274 (1999)
20230899 Cabanos C; Tandang-Silvas MR; Odijk V; Brostedt P; Tanaka A; Utsumi S; Maruyama N Expression, purification, cross-reactivity and homology modeling of peanut profilin. Protein Expr Purif. 2010 Sep;73(1):36-45
23350842 Wang,Y.; Fu,T.J.; Howard,A.; Kothary,M.H.; McHugh,T.H.; Zhang,Y.Z.; Crystal structure of peanut (Arachis hypogaea) allergen Ara h 5 J. Agric. Food Chem. (2013) In press