Allergen

AAD55792.2

Accession AAD55792.2
External DB Link NCBI Protein
Species Mesocricetus auratus
Common Name golden hamster
Description lipocalin
IUIS Name Mes a 1
Length 172
Year Adopted 2016
Sequence >AAD55792.2 Mes a 1; lipocalin [Mesocricetus auratus]
MVKFLLLALALGVSCAQHQNLEVSPSEVDGKWHSLYIAADNKSKVSEGGPLRVYVKHLEC
SDECQTFTIKFYTKVENVCQEHRVVGRKGKDGKYITDFSGQNYFHVVEKADDTMTFHNVN
VDDSGKTNVILVVGKGESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTCNQ
Parent Accession

Related Articles

Pubmed Authors Title Journal
10561587 Thavathiru,E.; Jana,N.R.; De,P.K.; Abundant secretory lipocalins displaying male and lactation-specific expression in adult hamster submandibular gland. cDNA cloning and sex hormone-regulated repression Eur. J. Biochem. 266 (2), 467-476 (1999)
15950295 Srikantan,S.; Parekh,V.; De,P.K.; cDNA cloning and regulation of two sex-hormone-repressed hamster tear lipocalins having homology with odorant/pheromone-binding proteins Biochim. Biophys. Acta 1729 (3), 154-165 (2005)
25765367 Hilger C; Dubey VP; Lentz D; Davril C; Revets D; Muller CP; Diederich C; De La Barrière H; Codreanu-Morel F; Morisset M; Lehners C; De PK; Hentges F Male-specific submaxillary gland protein, a lipocalin allergen of the golden hamster, differs from the lipocalin allergens of Siberian and Roborovski dwarf hamsters. Int Arch Allergy Immunol. 2015;166(1):30-40