Allergen

AAF31152.1

Accession AAF31152.1
External DB Link NCBI Protein
Species Olea europaea
Common Name olive
Description calcium-binding protein, polcalcin
IUIS Name Ole e 8
Length 171
Year Adopted 2007
Sequence >AAF31152.1 Ole e 8; calcium-binding protein, polcalcin [Olea europaea]
MAANTDRNSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARM
MEEIDTDKDGFINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKI
LTRLGERYAEHDCVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNSQAEPPK
Parent Accession

Related Articles

Pubmed Authors Title Journal
10648840 Ledesma,A.; Villalba,M.; Rodriguez,R. Cloning, expression and characterization of a novel four EF-hand Ca(2+)-binding protein from olive pollen with allergenic activity FEBS Lett. 466 (1), 192-196 (2000)
11991287 Ledesma A; Villalba M; Vivanco F; Rodriguez R Olive pollen allergen Ole e 8: identification in mature pollen and presence of Ole e 8-like proteins in different pollens. Allergy. 2002 Jan;57(1):40-3
12372128 Ledesma A; Gonzalez E; Pascual CY; Quiralte J; Villalba M; Rodriguez R Are Ca2+-binding motifs involved in the immunoglobin E-binding of allergens? Olive pollen allergens as model of study. Clin Exp Allergy. 2002 Oct;32(10):1476-83