Allergen

AAG35601.1

Accession AAG35601.1
External DB Link NCBI Protein
Species Zea mays
Common Name corn
Description profilin
IUIS Name Zea m 12
Length 131
Year Adopted 2015
Sequence >AAG35601.1 Zea m 12; profilin [Zea mays]
MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL
APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE
RLGDYLIEQGF
Parent Accession

Related Articles

Pubmed Authors Title Journal
9500760 Niederberger V; Laffer S; Froschl R; Kraft D; Rumpold H; Kapiotis S; Valenta R; Spitzauer S IgE antibodies to recombinant pollen allergens (Phl p 1, Phl p 2, Phl p 5, and Bet v 2) account for a high percentage of grass pollen-specific IgE. J Allergy Clin Immunol. 1998 Feb;101(2 Pt 1):258-64
16364168 Weichel M; Vergoossen NJ; Bonomi S; Scibilia J; Ortolani C; Ballmer-Weber BK; Pastorello EA; Crameri R Screening the allergenic repertoires of wheat and maize with sera from double-blind, placebo-controlled food challenge positive patients. Allergy. 2006 Jan;61(1):128-35