Allergen

AAK58515.1

Accession AAK58515.1
External DB Link NCBI Protein
Species Olea europaea
Common Name olive
Description beta-1,3-glucanase
IUIS Name Ole e 9
Length 460
Year Adopted 2007
Sequence >AAK58515.1 Ole e 9; beta-1,3-glucanase [Olea europaea]
MAANVQTSSLLFLVFLLLQNFYSANSQSFLGVNYGQLSDNLPSLQATVNLLKSTTIQKVR
LFGAEPAVIKAFANTGVEIVIGFDNGDIPTLASNPNVASQFVKSNVMSFYPASNIIAITV
GNEVLTSGDQKLISQLLPAMQNVQNALNAASLGGKVKVSTVHAMAVLSQSYPPSSGVFNP
GLGDTMKALLQFQSANDAPFMISPYPYFAYKNQPTPDTLAFCLFQPNAGQVDSGNGHKYT
NMFDAQVDAVHSALNAMGFKDIEIVVAETGWPHGGDSNEVGPSLDNAKAYVGNLINHLKS
KVGTPLMPGKSIDTYLFSLYDEDKKTGASSEKYFGLFKPDGSTTYDVGLLKNTQNPTTPA
TPTPTPKAAGSWCVPKPGVSDDQLTGNINYACGQGIDCGPIQPGGACFEPNTVKAHAAYV
MNLYYQSAGRNSWNCDFSQTATLTNTNPSYGACNFPSGSN
Parent Accession

Related Articles

Pubmed Authors Title Journal
11373288 Huecas,S.; Villalba,M.; Rodriguez,R. Ole e 9, a major olive pollen allergen is a 1,3-beta-glucanase. Isolation, characterization, amino acid sequence, and tissue specificity J. Biol. Chem. 276 (30), 27959-27966 (2001)
9500754 Boluda,L.; Alonso,C.; Fernandez-Caldas,E. Purification, characterization, and partial sequencing of two new allergens of Olea europaea J. Allergy Clin. Immunol. 101 (2 PT 1), 210-216 (1998)
12392450 Palomares O; Villalba M; Rodriguez R The C-terminal segment of the 1,3-beta-glucanase Ole e 9 from olive (Olea europaea) pollen is an independent domain with allergenic activity: expression in Pichia pastoris and characterization. Biochem J. 2003 Feb 1;369(Pt 3):593-601
15784114 Palomares O; Villalba M; Quiralte J; Polo F; Rodriguez R 1,3-beta-glucanases as candidates in latex-pollen-vegetable food cross-reactivity. Clin Exp Allergy. 2005 Mar;35(3):345-51
16892783 Palomares O; Villalba M; Quiralte J; Rodríguez R Allergenic contribution of the IgE-reactive domains of the 1,3-beta-glucanase Ole e 9: diagnostic value in olive pollen allergy. Ann Allergy Asthma Immunol. 2006 Jul;97(1):61-5
22385802 Esteve,C.; Montealegre,C.; Marina,M.L.; Garcia,M.C.; Analysis of olive allergens Talanta 92, 1-14 (2012)
18384450 Palomares O; Fernández-Nieto M; Villalba M; Rodríguez R; Cuesta-Herranz J Occupational allergy in a researcher due to Ole e 9, an allergenic 1,3-beta-glucanase from olive pollen. Allergy. 2008 Jun;63(6):784-5