Allergen

AAK96887.1

Accession AAK96887.1
External DB Link NCBI Protein
Species Arachis hypogaea
Common Name peanut
Description 2S albumin, conglutin
IUIS Name Ara h 2
Length 156
Year Adopted 2010
Sequence >AAK96887.1 Ara h 2; 2S albumin, conglutin [Arachis hypogaea]
MAKLTILVALALFLLAAHASARQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSY
ERDPYSPSQDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRL
QGRQQEQQFKRELRNLPQQCGLRAPQRCDLDVESGG
Parent Accession

Related Articles

Pubmed Authors Title Journal
15893698 Palmer GW; Dibbern DA Jr; Burks AW; Bannon GA; Bock SA; Porterfield HS; McDermott RA; Dreskin SC Comparative potency of Ara h 1 and Ara h 2 in immunochemical and functional assays of allergenicity. Clin Immunol. 2005 Jun;115(3):302-12
9824392 Clarke MC; Kilburn SA; Hourihane JO; Dean KR; Warner JO; Dean TP Serological characteristics of peanut allergy. Clin Exp Allergy. 1998 Oct;28(10):1251-7
15080811 Koppelman SJ; Wensing M; Ertmann M; Knulst AC; Knol EF Relevance of Ara h1, Ara h2 and Ara h3 in peanut-allergic patients, as determined by immunoglobulin E Western blotting, basophil-histamine release and intracutaneous testing: Ara h2 is the most important peanut allergen. Clin Exp Allergy. 2004 Apr;34(4):583-90
12759484 Chatel,J.M.; Bernard,H.; Orson,F.M.; Isolation and characterization of two complete Ara h 2 isoforms cDNA Int. Arch. Allergy Immunol. 131 (1), 14-18 (2003)
11295663 Viquez,O.M.; Summer,C.G.; Dodo,H.W.; Isolation and molecular characterization of the first genomic clone of a major peanut allergen, Ara h 2 J. Allergy Clin. Immunol. 107 (4), 713-717 (2001)
15769170 Gruber P; Becker WM; Hofmann T Influence of the maillard reaction on the allergenicity of rAra h 2, a recombinant major allergen from peanut (Arachis hypogaea), its major epitopes, and peanut agglutinin. J Agric Food Chem. 2005 Mar 23;53(6):2289-96
16614814 Ramos ML; Fleming G; Chu Y; Akiyama Y; Gallo M; Ozias-Akins P Chromosomal and phylogenetic context for conglutin genes in Arachis based on genomic sequence. Mol Genet Genomics. 2006 Jun;275(6):578-92
21305299 Jiang S; Wang S; Sun Y; Zhou Z; Wang G Molecular characterization of major allergens Ara h 1, 2, 3 in peanut seed. Plant Cell Rep. 2011 Jun;30(6):1135-43