Allergen

AAL14079.1

Accession AAL14079.1
External DB Link NCBI Protein
Species Cynodon dactylon
Common Name Bermuda grass
Description beta-expansin
IUIS Name Cyn d 1
Length 262
Year Adopted 2007
Sequence >AAL14079.1 Cyn d 1; beta-expansin [Cynodon dactylon]
MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC
GYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA
AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA
LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV
EQEDVIPEDWKPDTVYKSKIQF
Parent Accession

Related Articles

Pubmed Authors Title Journal
1955635 Matthiesen,F.; Schumacher,M.J.; Lowenstein,H. Characterization of the major allergen of Cynodon dactylon (Bermuda grass) pollen, Cyn d I J. Allergy Clin. Immunol. 88 (5), 763-774 (1991)
8757211 Smith,P.M.; Suphioglu,C.; Griffith,I.J.; Theriault,K.; Knox,R.B.; Singh,M.B. Cloning and expression in yeast Pichia pastoris of a biologically active form of Cyn d 1, the major allergen of Bermuda grass pollen J. Allergy Clin. Immunol. 98 (2), 331-343 (1996)
11906335 Au,L.C.; Lin,S.T.; Peng,H.J.; Liang,C.C.; Lee,S.S.; Liao,C.D.; Chang,Z.N. Molecular cloning and sequence analysis of full-length cDNAs encoding new group of Cyn d 1 isoallergens Allergy 57 (3), 215-220 (2002)
19776679 Tiwari R; Bhalla PL; Singh MB Evaluation of molecular basis of cross reactivity between rye and Bermuda grass pollen allergens. Allergol Int. 2009 Dec;58(4):557-64