Allergen

AAL37561.1

Accession AAL37561.1
External DB Link NCBI Protein
Species Arachis hypogaea
Common Name peanut
Description 2S albumin, conglutin
IUIS Name Ara h 6
Length 144
Year Adopted 2007
Sequence >AAL37561.1 Ara h 6; 2S albumin, conglutin [Arachis hypogaea]
AKSTILVALLALVLVAHASAMRRERGRQGDSSSCERQVDRVNLKPCEQHIMQRIMGEQEQ
YDSYDIRSTRSSDQQQRCCDELDQMENTERCMCEALQQIMENQCDRLQDRQMVQQFKREL
MNLPQQCNFRAPQRCDLDVSGGRC
Parent Accession

Related Articles

Pubmed Authors Title Journal
12582692 Paik-Ro,O.G.; Seib,J.C.; Smith,R.L. Seed-specific, developmentally regulated genes of peanut Theor. Appl. Genet. 104 (2-3), 236-240 (2002)
10474031 Kleber-Janke,T.; Crameri,R.; Appenzeller,U.; Schlaak,M.; Becker,W.M. Selective cloning of peanut allergens, including profilin and 2S albumins, by phage display technology Int. Arch. Allergy Immunol. 119 (4), 265-274 (1999)
15836759 Koppelman SJ; de Jong GA; Laaper-Ertmann M; Peeters KA; Knulst AC; Hefle SL; Knol EF Purification and immunoglobulin E-binding properties of peanut allergen Ara h 6: evidence for cross-reactivity with Ara h 2. Clin Exp Allergy. 2005 Apr;35(4):490-7
22677622 Asarnoj A; Glaumann S; Elfström L; Lilja G; Lidholm J; Nilsson C; Wickman M Anaphylaxis to peanut in a patient predominantly sensitized to Ara h 6. Int Arch Allergy Immunol. 2012;159(2):209-12