Allergen

AAL79930.1

Accession AAL79930.1
External DB Link NCBI Protein
Species Fusarium culmorum
Common Name fungus
Description ribosomal protein P2
IUIS Name Fus c 1
Length 109
Year Adopted 2007
Sequence >AAL79930.1 Fus c 1; ribosomal protein P2 [Fusarium culmorum]
MKHLAAYLLLGLGGNTSPSAADVKAVLTSVGIDADEDRLNKLISELEGKDIQQLIAEGSE
KLASVPSGGAGGASGGAAAAGGAAEEAKEEEKEEEKEESDEDMGFGLFD
Parent Accession

Related Articles

Pubmed Authors Title Journal
12695122 Hoff M; Ballmer-Weber BK; Niggemann B; Cistero-Bahima A; San Miguel-Moncin M; Conti A; Haustein D; Vieths S Molecular cloning and immunological characterisation of potential allergens from the mould Fusarium culmorum. Mol Immunol. 2003 May;39(15):965-75
12743577 Hoff M; Trueb RM; Ballmer-Weber BK; Vieths S; Wuethrich B Immediate-type hypersensitivity reaction to ingestion of mycoprotein (Quorn) in a patient allergic to molds caused by acidic ribosomal protein P2. J Allergy Clin Immunol. 2003 May;111(5):1106-10