Allergen

AAL91662.1

Accession AAL91662.1
External DB Link NCBI Protein
Species Prunus dulcis
Common Name almond
Description profilin
IUIS Name Pru du 4
Length 131
Year Adopted 2007
Sequence >AAL91662.1 Pru du 4; profilin [Prunus dulcis]
MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL
APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE
RLGDYLIEQGL
Parent Accession

Related Articles

Pubmed Authors Title Journal
11419723 Scheurer,S.; Wangorsch,A.; Nerkamp,J.; Skov,P.S.; Ballmer-Weber,B.; Wuthrich,B.; Haustein,D.; Vieths,S. Cross-reactivity within the profilin panallergen family investigated by comparison of recombinant profilins from pear (Pyr c 4), cherry (Pru av 4) and celery (Api g 4) with birch pollen profilin Bet v 2 J. Chromatogr. B Biomed. Sci. Appl. 756 (1-2), 315-325 (2001)
12823124 Rodriguez-Perez,R.; Fernandez-Rivas,M.; Gonzalez-Mancebo,E.; Sanchez-Monge,R.; Diaz-Perales,A.; Salcedo,G. Peach profilin: cloning, heterologous expression and cross-reactivity with Bet v 2 Allergy 58 (7), 635-640 (2003)
11295665 Scheurer,S.; Pastorello,E.A.; Wangorsch,A.; Kastner,M.; Haustein,D.; Vieths,S. Recombinant allergens Pru av 1 and Pru av 4 and a newly identified lipid transfer protein in the in vitro diagnosis of cherry allergy J. Allergy Clin. Immunol. 107 (4), 724-731 (2001)
17030246 Tawde,P.; Venkatesh,Y.P.; Wang,F.; Teuber,S.S.; Sathe,S.K.; Roux,K.H.; Cloning and characterization of profilin (Pru du 4), a cross-reactive almond (Prunus dulcis) allergen J. Allergy Clin. Immunol. 118 (4), 915-922 (2006)
19014629 Chen,L.; Zhang,S.; Illa,E.; Song,L.; Wu,S.; Howad,W.; Arus,P.; van de Weg,E.; Chen,K.; Gao,Z.; Genomic characterization of putative allergen genes in peach/almond and their synteny with apple BMC Genomics 9, 543 (2008)