Allergen

AAM77471.1

Accession AAM77471.1
External DB Link NCBI Protein
Species Alternaria alternata
Common Name fungus
Description unknown function, partial
IUIS Name Alt a 1
Length 115
Year Adopted 2007
Sequence >AAM77471.1 Alt a 1; unknown function, partial [Alternaria alternata]
MQFTTIASLFAAAGLAAAAPLESRQDNASCPVTTKGDYVWKISEFYGRKPEGTYYNSLGF
NIKATNGGTLDFTCSAQADKLEDHKWYSCGENSFMDFSFDSDRSGLLLKQKVSDE
Parent Accession

Related Articles

Pubmed Authors Title Journal
8957113 De Vouge,M.W.; Thaker,A.J.; Curran,I.H.; Zhang,L.; Muradia,G.; Rode,H.; Vijay,H.M. Isolation and expression of a cDNA clone encoding an Alternaria alternata Alt a 1 subunit Int. Arch. Allergy Immunol. 111 (4), 385-395 (1996)
12444314 Kurup VP; Shen HD; Vijay H Immunobiology of fungal allergens. Int Arch Allergy Immunol. 2002 Nov;129(3):181-8
15940136 Asturias JA; Ibarrola I; Ferrer A; Andreu C; Lopez-Pascual E; Quiralte J; Florido F; Martinez A Diagnosis of Alternaria alternata sensitization with natural and recombinant Alt a 1 allergens. J Allergy Clin Immunol. 2005 Jun;115(6):1210-7
18036643 Schmechel D; Green BJ; Blachere FM; Janotka E; Beezhold DH Analytical bias of cross-reactive polyclonal antibodies for environmental immunoassays of Alternaria alternata. J Allergy Clin Immunol. 2008 Mar;121(3):763-8
10.1007/s11557-011-0793-7 Lawrence,D.P.; Park,M.S.; Pryor,B.M.; Nimbya and Embellisia revisited, with nov. comb for Alternaria celosiae and A. perpunctulata Mycol. Prog. (2012) In press
22664167 Chruszcz,M.; Chapman,M.D.; Osinski,T.; Solberg,R.; Demas,M.; Porebski,P.J.; Majorek,K.A.; Pomes,A.; Minor,W.; Alternaria alternata allergen Alt a 1: A unique beta-barrel protein dimer found exclusively in fungi J. Allergy Clin. Immunol. (2012) In press
12668200 Kurup VP; Vijay HM; Kumar V; Castillo L; Elms N IgE binding synthetic peptides of Alt a 1, a major allergen of Alternaria alternata. Peptides. 2003 Feb;24(2):179-85
11737041 Vailes LD; Perzanowski MS; Wheatley LM; Platts-Mills TA; Chapman MD IgE and IgG antibody responses to recombinant Alt a 1 as a marker of sensitization to Alternaria in asthma and atopic dermatitis. Clin Exp Allergy. 2001 Dec;31(12):1891-5