Allergen

AAO32314.1

Accession AAO32314.1
External DB Link NCBI Protein
Species Carya illinoinensis
Common Name pecan
Description 2S albumin, conglutin
IUIS Name Car i 1
Length 143
Year Adopted 2007
Sequence >AAO32314.1 Car i 1; 2S albumin, conglutin [Carya illinoinensis]
MARVAALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGESCREQIQRQQYLNRCQDYL
RQQCRSGGYDEDNQRQHFRQCCQQLSQMEEQCQCEGLRQAVRQQQQEEGIRGEEMEEMVQ
CASDLPKECGISSRSCEIRRSWF
Parent Accession

Related Articles

Pubmed Authors Title Journal
16095141 Goetz DW; Whisman BA; Goetz AD Cross-reactivity among edible nuts: double immunodiffusion, crossed immunoelectrophoresis, and human specific igE serologic surveys. Ann Allergy Asthma Immunol. 2005 Jul;95(1):45-52
15899521 Barre A; Borges JP; Culerrier R; Rouge P Homology modelling of the major peanut allergen Ara h 2 and surface mapping of IgE-binding epitopes. Immunol Lett. 2005 Sep 15;100(2):153-8
21395309 Sharma GM; Irsigler A; Dhanarajan P; Ayuso R; Bardina L; Sampson HA; Roux KH; Sathe SK Cloning and characterization of 2S albumin, Car i 1, a major allergen in pecan. J Agric Food Chem. 2011 Apr 27;59(8):4130-9