Allergen

AAO45607.1

Accession AAO45607.1
External DB Link NCBI Protein
Species Zea mays
Common Name corn
Description beta-expansin
IUIS Name Zea m 1
Length 269
Year Adopted 2007
Sequence >AAO45607.1 Zea m 1; beta-expansin [Zea mays]
MGSLANNIMVVGAVLAALVVGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAP
DNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDM
NYEPIAPYHFDLSGKAFGSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGC
NPNYVAVLVKFVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTS
ESGKKVIAKDIIPANWRPDAVYTSNVQFY
Parent Accession

Related Articles

Pubmed Authors Title Journal
9177257 Cosgrove,D.J.; Bedinger,P.; Durachko,D.M. Group I allergens of grass pollen as cell wall-loosening agents Proc. Natl. Acad. Sci. U.S.A. 94 (12), 6559-6564 (1997)
9500760 Niederberger V; Laffer S; Froschl R; Kraft D; Rumpold H; Kapiotis S; Valenta R; Spitzauer S IgE antibodies to recombinant pollen allergens (Phl p 1, Phl p 2, Phl p 5, and Bet v 2) account for a high percentage of grass pollen-specific IgE. J Allergy Clin Immunol. 1998 Feb;101(2 Pt 1):258-64
1382820 Van Ree R; Driessen MN; Van Leeuwen WA; Stapel SO; Aalberse RC Variability of crossreactivity of IgE antibodies to group I and V allergens in eight grass pollen species. Clin Exp Allergy. 1992 Jun;22(6):611-7
16364168 Weichel M; Vergoossen NJ; Bonomi S; Scibilia J; Ortolani C; Ballmer-Weber BK; Pastorello EA; Crameri R Screening the allergenic repertoires of wheat and maize with sera from double-blind, placebo-controlled food challenge positive patients. Allergy. 2006 Jan;61(1):128-35
7537171 Astwood JD; Mohapatra SS; Ni H; Hill RD Pollen allergen homologues in barley and other crop species. Clin Exp Allergy. 1995 Jan;25(1):66-72
8406014 Broadwater AH; Rubinstein AL; Chay CH; Klapper DG; Bedinger PA Zea mI, the maize homolog of the allergen-encoding Lol pI gene of rye grass. Gene. 1993 Sep 15;131(2):227-30