Allergen

AAP15201.1

Accession AAP15201.1
External DB Link NCBI Protein
Species Ambrosia artemisiifolia
Common Name short ragweed
Description profilin
IUIS Name Amb a 8
Length 131
Year Adopted 2007
Sequence >AAP15201.1 Amb a 8; profilin [Ambrosia artemisiifolia]
MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGVVWAQSATFPQVKPEEITGIMNDFNEPGSL
APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTTMALIIGIYDEPMAPGQCNMIVE
RLGDYLLEQGF
Parent Accession

Related Articles

Pubmed Authors Title Journal
16174439 Tao AL; He SH Cloning, expression, and characterization of pollen allergens from Humulus scandens (Lour) Merr and Ambrosia artemisiifolia L. Acta Pharmacol Sin. 2005 Oct;26(10):1225-32
16254437 Wopfner N; Gadermaier G; Egger M; Asero R; Ebner C; Jahn-Schmid B; Ferreira F The spectrum of allergens in ragweed and mugwort pollen. Int Arch Allergy Immunol. 2005 Dec;138(4):337-46
18588553 Wopfner N; Gruber P; Wallner M; Briza P; Ebner C; Mari A; Richter K; Vogel L; Ferreira F Molecular and immunological characterization of novel weed pollen pan-allergens. Allergy. 2008 Jul;63(7):872-81