Allergen

AAP57094.1

Accession AAP57094.1
External DB Link NCBI Protein
Species Dermatophagoides farinae
Common Name house dust mite
Description arginine kinase
IUIS Name Der f 20
Length 356
Year Adopted 2008
Sequence >AAP57094.1 Der f 20; arginine kinase [Dermatophagoides farinae]
MVDQAVIDKLEAGFQKLQSSAECHSLLKKYLTRNVLDACKGRKTGMGATLVDVVQSGFEN
LDSGVGLYAPDAESYTLFKELFDPVIEDYHKGFKPTDKHPQTDFGDVNTLCNVDPNNEFV
ISTRVRCGRSLQGYPFNPCLTEAQYKEMEEKVKGQLNSFEGELKGTYYPLLGMDKATQQQ
LIDDHFLFKEGDRFLQAANACRFWPVGRGIFHNDNKTFLIWVNEEEHLRIISMQKGGDLK
QVFSRLINGVNHIEKKLPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKXLEEV
AGKYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKSM
Parent Accession

Related Articles

Pubmed Authors Title Journal
17845417 Hales BJ; Laing IA; Pearce LJ; Hazell LA; Mills KL; Chua KY; Thornton RB; Richmond P; Musk AW; James AL; Lesouef PN; Thomas WR Distinctive immunoglobulin E anti-house dust allergen-binding specificities in a tropical Australian Aboriginal community. Clin Exp Allergy. 2007 Sep;37(9):1357-63
18220991 Thomas WR; Heinrich TK; Smith WA; Hales BJ Pyroglyphid house dust mite allergens. Protein Pept Lett. 2007;14(10):943-53
16890759 Hales BJ; Martin AC; Pearce LJ; Laing IA; Hayden CM; Goldblatt J; Le Souëf PN; Thomas WR IgE and IgG anti-house dust mite specificities in allergic disease. J Allergy Clin Immunol. 2006 Aug;118(2):361-7
23481662 An S; Chen L; Long C; Liu X; Xu X; Lu X; Rong M; Liu Z; Lai R Dermatophagoides farinae allergens diversity identification by proteomics. Mol Cell Proteomics. 2013 Jul;12(7):1818-28
N/A: See Journal R Goodman and Su An Dermatophagoides farinae seq and paper inquiries Correspondence Email 1
24978201 Gámez C; Zafra M; Boquete M; Sanz V; Mazzeo C; Ibáñez MD; Sánchez-García S; Sastre J; del Pozo V New shrimp IgE-binding proteins involved in mite-seafood cross-reactivity. Mol Nutr Food Res. 2014 Sep;58(9):1915-25
26433526 Thomas WR Hierarchy and molecular properties of house dust mite allergens. Allergol Int. 2015 Oct;64(4):304-11