Allergen

AAQ73492.1

Accession AAQ73492.1
External DB Link NCBI Protein
Species Lepidoglyphus destructor
Common Name storage mite
Description NPC2-like
IUIS Name Lep d 2
Length 141
Year Adopted 2007
Sequence >AAQ73492.1 Lep d 2; NPC2-like [Lepidoglyphus destructor]
MMKFIVLFALVAVASAGKMKFKDCGKGEVTELDITDCSGDFCVLHRGKSVTLDAKFVANQ
DSAKATIKVLAKVVGTQIQVPGFDTDGCKIIKCPIKKGDPIDFKYSGTIPAITPKIKAEV
TAELIGDHGILACGTVNGTVE
Parent Accession

Related Articles

Pubmed Authors Title Journal
12581204 Kaiser,L.; Gafvelin,G.; Johansson,E.; van Hage-Hamsten,M.; Rasool,O. Lep d 2 polymorphisms in wild and cultured Lepidoglyphus destructor mites Eur. J. Biochem. 270 (4), 646-653 (2003)
1611545 Ventas P; Carreira J; Polo F Purification and characterization of Lep d I, a major allergen from the mite Lepidoglyphus destructor. Clin Exp Allergy. 1992 Apr;22(4):454-60
11641606 Olsson S; van Hage-Hamsten M; Magnusson CG IgG1, IgG4 and IgE antibody reactivity to mutant forms of the major dust mite allergen Lep d 2 among atopic and nonatopic subjects naturally exposed to Lepidoglyphus destructor. Int Arch Allergy Immunol. 2001 Sep;126(1):50-8