Allergen

AAQ91847.1

Accession AAQ91847.1
External DB Link NCBI Protein
Species Arachis hypogaea
Common Name peanut
Description pathogenesis related protein, PR-10, Bet v 1-like
IUIS Name Ara h 8
Length 157
Year Adopted 2007
Sequence >AAQ91847.1 Ara h 8; pathogenesis related protein, PR-10, Bet v 1-like [Arachis hypogaea]
MGVFTFEDEITSTVPPAKLYNAMKDADSITPKIIDDVKSVEIVEGNGGPGTIKKLTIVED
GETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKYH
TKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY
Parent Accession

Related Articles

Pubmed Authors Title Journal
15577846 Mittag,D.; Akkerdaas,J.; Ballmer-Weber,B.K.; Vogel,L.; Wensing,M.; Becker,W.M.; Koppelman,S.J.; Knulst,A.C.; Helbling,A.; Hefle,S.L.; Van Ree,R.; Vieths,S. Ara h 8, a Bet v 1-homologous allergen from peanut, is a major allergen in patients with combined birch pollen and peanut allergy J. Allergy Clin. Immunol. 114 (6), 1410-1417 (2004)
18208358 Riecken,S.; Lindner,B.; Petersen,A.; Jappe,U.; Becker,W.M.; Purification and characterization of natural Ara h 8, the Bet v 1 homologous allergen from peanut, provides a novel isoform (er) Biol. Chem. (2008) In press
16832688 Chadha,P.; Das,R.H.; A pathogenesis related protein, AhPR10 from peanut: an insight of its mode of antifungal activity Planta 225 (1), 213-222 (2006)