Allergen

AAR92223.1

Accession AAR92223.1
External DB Link NCBI Protein
Species Actinidia deliciosa
Common Name green kiwifruit
Description phytocystatin
IUIS Name Act d 4
Length 116
Year Adopted 2007
Sequence >AAR92223.1 Act d 4; phytocystatin [Actinidia deliciosa]
MVPKPLSLLLFLLLALSAAVVGGRKLVAAGGWRPIESLNSAEVQDVAQFAVSEHNKQAND
ELQYQSVVRGYTQVVAGTNYRLVIAAKDGAVVGNYEAVVWDKPWMHFRNLTSFRKV
Parent Accession

Related Articles

Pubmed Authors Title Journal
14697268 Rassam,M.; Laing,W.A.; Purification and characterization of phytocystatins from kiwifruit cortex and seeds Phytochemistry 65 (1), 19-30 (2004)
15536427 Bublin M; Mari A; Ebner C; Knulst A; Scheiner O; Hoffmann-Sommergruber K; Breiteneder H; Radauer C IgE sensitization profiles toward green and gold kiwifruits differ among patients allergic to kiwifruit from 3 European countries. J Allergy Clin Immunol. 2004 Nov;114(5):1169-75
18205857 Palacin A; Rodriguez J; Blanco C; Lopez-Torrejon G; Sánchez-Monge R; Varela J; Jiménez MA; Cumplido J; Carrillo T; Crespo JF; Salcedo G Immunoglobulin E recognition patterns to purified Kiwifruit (Actinidinia deliciosa) allergens in patients sensitized to Kiwi with different clinical symptoms. Clin Exp Allergy. 2008 Jul;38(7):1220-8
20061012 Bublin M; Pfister M; Radauer C; Oberhuber C; Bulley S; Dewitt AM; Lidholm J; Reese G; Vieths S; Breiteneder H; Hoffmann-Sommergruber K; Ballmer-Weber BK Component-resolved diagnosis of kiwifruit allergy with purified natural and recombinant kiwifruit allergens. J Allergy Clin Immunol. 2010 Mar;125(3):687-94, 694.e1
19885843 Popovic,M.M.; Milovanovic,M.; Burazer,L.; Vuckovic,O.; Hoffmann-Sommergruber,K.; Knulst,A.C.; Lindner,B.; Petersen,A.; Jankov,R.; Gavrovic-Jankulovic,M.; Cysteine proteinase inhibitor Act d 4 is a functional allergen contributing to the clinical symptoms of kiwifruit allergy Mol Nutr Food Res 54 (3), 373-380 (2010)