Allergen

AAS67043.1

Accession AAS67043.1
External DB Link NCBI Protein
Species Polistes dominula
Common Name paper wasp
Description phospholipase A1
IUIS Name Pol d 1
Length 316
Year Adopted 2007
Sequence >AAS67043.1 Pol d 1; phospholipase A1 [Polistes dominula]
ADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH
QIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVG
NTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGL
DPAGPSFLTSKCPDRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSC
SHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYV
PVDKDAPYCHNEGIKL
Parent Accession

Related Articles

Pubmed Authors Title Journal
8828537 King,T.P.; Lu,G.; Gonzalez,M.; Qian,N.; Soldatova,L. Yellow jacket venom allergens, hyaluronidase and phospholipase: sequence similarity and antigenic cross-reactivity with their hornet and wasp homologs and possible implications for clinical allergy J. Allergy Clin. Immunol. 98 (3), 588-600 (1996)
14572904 Pantera,B.; Hoffman,D.R.; Carresi,L.; Cappugi,G.; Turillazzi,S.; Manao,G.; Severino,M.; Spadolini,I.; Orsomando,G.; Moneti,G.; Pazzagli,L.; Characterization of the major allergens purified from the venom of the paper wasp Polistes gallicus Biochim. Biophys. Acta 1623 (2-3), 72-81 (2003)
3989146 Hoffman DR Allergens in Hymenoptera venom XIV: IgE binding activities of venom proteins from three species of vespids. J Allergy Clin Immunol. 1985 May;75(5):606-10
16197464 Bilo BM; Rueff F; Mosbech H; Bonifazi F; Oude-Elberink JN; the EAACI Interest Group on Insect Venom Hypersensitivity* Diagnosis of Hymenoptera venom allergy. Allergy. 2005 Nov;60(11):1339-49