Allergen

AAT00596.1

Accession AAT00596.1
External DB Link NCBI Protein
Species Arachis hypogaea
Common Name peanut
Description 7S globulin, vicilin, partial
IUIS Name Ara h 1
Length 428
Year Adopted 2007
Sequence >AAT00596.1 Ara h 1; 7S globulin, vicilin, partial [Arachis hypogaea]
GFDQRSRQFQNLQNHRIVQIEAKPNTLVLPKHADADNILVIQQGQATVTVANGNNRKSFN
LDEGHALRIPSGFISYILNRHDNQNLRVAKISMPVNTPGQFEDFFPASSRDQSSYLQGFS
RNTLEAAFNAEFNEIRRVLLEENAGGEQEERGQRRWSTRSSENNEGVIVKVSKEHVEELT
KHAKSVSKKGSEEGDITNPINLREGEPDLSNNFGKLFEVKPDKKNPQLQDLDMMLTCVEI
KEGALMLPHFNSKAMVIVVVNKGTGNLELVAVRKEQQQRGRREEEEDEDEEEEGSNREVR
RYTARLKEGDVFIMPAAHPVAINASSELHLLGFGINAENNHRIFLAGDKDNVIDQIEKQA
KDLAFPGSGEQVEKLIKNQKESHFVSARPQSQSQSPSSPEKESPEKEDQEEENQGGKGPL
LSILKAFN
Parent Accession

Related Articles

Pubmed Authors Title Journal
7560062 Burks,A.W.; Cockrell,G.; Stanley,J.S.; Helm,R.M.; Bannon,G.A. Recombinant peanut allergen Ara h I expression and IgE binding in patients with peanut hypersensitivity J. Clin. Invest. 96 (4), 1715-1721 (1995)
9151961 Burks AW; Shin D; Cockrell G; Stanley JS; Helm RM; Bannon GA Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity. Eur J Biochem. 1997 Apr 15;245(2):334-9
15893698 Palmer GW; Dibbern DA Jr; Burks AW; Bannon GA; Bock SA; Porterfield HS; McDermott RA; Dreskin SC Comparative potency of Ara h 1 and Ara h 2 in immunochemical and functional assays of allergenicity. Clin Immunol. 2005 Jun;115(3):302-12
15080811 Koppelman SJ; Wensing M; Ertmann M; Knulst AC; Knol EF Relevance of Ara h1, Ara h2 and Ara h3 in peanut-allergic patients, as determined by immunoglobulin E Western blotting, basophil-histamine release and intracutaneous testing: Ara h2 is the most important peanut allergen. Clin Exp Allergy. 2004 Apr;34(4):583-90
21305299 Jiang S; Wang S; Sun Y; Zhou Z; Wang G Molecular characterization of major allergens Ara h 1, 2, 3 in peanut seed. Plant Cell Rep. 2011 Jun;30(6):1135-43
21917921 Chruszcz,M.; Maleki,S.J.; Majorek,K.A.; Demas,M.; Bublin,M.; Solberg,R.; Hurlburt,B.K.; Ruan,S.; Mattisohn,C.P.; Breiteneder,H.; Minor,W.; Structural and immunologic characterization of Ara h 1, a major peanut allergen J. Biol. Chem. 286 (45), 39318-39327 (2011)