Allergen

AAU21499.2

Accession AAU21499.2
External DB Link NCBI Protein
Species Arachis hypogaea
Common Name peanut
Description oleosin
IUIS Name Ara h 10
Length 169
Year Adopted 2015
Sequence >AAU21499.2 Ara h 10; oleosin [Arachis hypogaea]
MTDRTQPHTVQVHTTAGRFGDTAAGTNRYPDRGPSTSKVIAVITGLPIGGTLLLFAGLAL
AGTLLGLAVTTPLFILFSPVIVPAIIVVGLSVAGFLTSGACGLTGLSSFSWVMNYIRQTH
GSVPEQLEMAKHRMADVAGYVGQKTKDVGQKTKEVGQEIQTKAQDSKRT
Parent Accession

Related Articles

Pubmed Authors Title Journal
21853336 Cabanos C; Katayama H; Tanaka A; Utsumi S; Maruyama N Expression and purification of peanut oleosins in insect cells. Protein J. 2011 Oct;30(7):457-63
22128159 Parthibane V; Rajakumari S; Venkateshwari V; Iyappan R; Rajasekharan R Oleosin is bifunctional enzyme that has both monoacylglycerol acyltransferase and phospholipase activities. J Biol Chem. 2012 Jan 13;287(3):1946-54
25860789 Schwager C; Kull S; Krause S; Schocker F; Petersen A; Becker WM; Jappe U Development of a novel strategy to isolate lipophilic allergens (oleosins) from peanuts. PLoS One. 2015;10(4):e0123419