Allergen

AAX11194.1

Accession AAX11194.1
External DB Link NCBI Protein
Species Penicillium brevicompactum
Common Name fungus
Description acidic ribosomal protein P1
IUIS Name Pen b 26
Length 107
Year Adopted 2007
Sequence >AAX11194.1 Pen b 26; acidic ribosomal protein P1 [Penicillium brevicompactum]
MSTAELAVSYAALILADDGIEVSADKIQTILGAAKVQEVEPIWATIFAKALEGKDIKEIL
TNVGSAGPATAGAPAAAGAAAPAEEKKEEKEEEKEESDEDMGFGLFD
Parent Accession

Related Articles

Pubmed Authors Title Journal
16088208 Sevinc,M.S.; Kumar,V.; Abebe,M.; Casley,W.L.; Vijay,H.M.; Isolation and Characterization of a cDNA Clone Encoding One IgE-Binding Fragment of Penicillium brevicompactum (er) Int. Arch. Allergy Immunol. 138 (1), 12-20 (2005)
19248220 Sevinc MS; Kumar V; Abebe M; Mohottalage S; Kumarathasan P; Vincent R; Vijay HM Expression and characterization of Pen b 26 allergen of Penicillium brevicompactum in Escherichia coli. Protein Expr Purif. 2009 May;65(1):8-14
23902156 Sevinc MS; Kumar V; Abebe M; Lemieux M; Vijay HM Isolation, expression and characterization of a minor allergen from Penicillium crustosum. Med Mycol. 2013 Aug 1;