Allergen

AAX19858.1

Accession AAX19858.1
External DB Link NCBI Protein
Species Malus domestica
Common Name apple
Description profilin
IUIS Name Mal d 4
Length 131
Year Adopted 2007
Sequence >AAX19858.1 Mal d 4; profilin [Malus domestica]
MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL
APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE
RLGDYLIEQGL
Parent Accession

Related Articles

Pubmed Authors Title Journal
7897156 van Ree R; Fernandez-Rivas M; Cuevas M; van Wijngaarden M; Aalberse RC Pollen-related allergy to peach and apple: an important role for profilin. J Allergy Clin Immunol. 1995 Mar;95(3):726-34
12209091 Wensing M; Akkerdaas JH; van Leeuwen WA; Stapel SO; Bruijnzeel-Koomen CA; Aalberse RC; Bast BJ; Knulst AC; van Ree R IgE to Bet v 1 and profilin: cross-reactivity patterns and clinical relevance. J Allergy Clin Immunol. 2002 Sep;110(3):435-42
12023194 Vieths S; Scheurer S; Ballmer-Weber B Current understanding of cross-reactivity of food allergens and pollen. Ann N Y Acad Sci. 2002 May;964:47-68
16911365 Ma Y; Zuidmeer L; Bohle B; Bolhaar ST; Gadermaier G; Gonzalez-Mancebo E; Fernandez-Rivas M; Knulst AC; Himly M; Asero R; Ebner C; van Ree R; Ferreira F; Breiteneder H; Hoffmann-Sommergruber K Characterization of recombinant Mal d 4 and its application for component-resolved diagnosis of apple allergy. Clin Exp Allergy. 2006 Aug;36(8):1087-96