Allergen

AAY84565.1

Accession AAY84565.1
External DB Link NCBI Protein
Species Dermatophagoides pteronyssinus
Common Name house dust mite
Description chitinase
IUIS Name Der p 15
Length 532
Year Adopted 2007
Sequence >AAY84565.1 Der p 15; chitinase [Dermatophagoides pteronyssinus]
MKTSCAILILMACFGLMNAAVKRDHNNYSKNPMRIVCYVGTWSVYHKVDPYTIEDIDPFK
CTHLMYGFAKIDEYKYTIQVFDPYQDDNHNTWEKHGYERFNNLRLKNPELTTMISLGGWY
EGSEKYSDMVANPTYRKQFVQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYLTLV
RELKEAFEPFGYLLTAAVSPGKDKIDVAYELKELNQLFDWMNVMTYDYHGGWENVFGHNA
PLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKVKLGDPA
KGMSPPGFITGEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISC
KLAFLKELGVSGVMIWSLENDDFKGHCGPKYPLLNKVHNMINGDEKNSYECLLGPSTTTP
TPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTPSTTTPTPTTTDSTSETPKYTTYVDGH
LIKCYKEGDLPHPTNIHKYLVCEYVNGGWWVHIMPCPPGTIWCQEKLTCITE
Parent Accession

Related Articles

Pubmed Authors Title Journal
11292526 McCall,C.; Hunter,S.; Stedman,K.; Weber,E.; Hillier,A.; Bozic,C.; Rivoire,B.; Olivry,T. Characterization and cloning of a major high molecular weight house dust mite allergen (Der f 15) for dogs Vet. Immunol. Immunopathol. 78 (3-4), 231-247 (2001)
18220991 Thomas WR; Heinrich TK; Smith WA; Hales BJ Pyroglyphid house dust mite allergens. Protein Pept Lett. 2007;14(10):943-53
16776685 ONeil SE; Heinrich TK; Hales BJ; Hazell LA; Holt DC; Fischer K; Thomas WR The chitinase allergens Der p 15 and Der p 18 from Dermatophagoides pteronyssinus. Clin Exp Allergy. 2006 Jun;36(6):831-9
9802372 Le Mao J; Mayer CE; Peltre G; Desvaux FX; David B; Weyer A; Sénéchal H Mapping of Dermatophagoides farinae mite allergens by two-dimensional immunoblotting. J Allergy Clin Immunol. 1998 Oct;102(4 Pt 1):631-6
23075813 Hales BJ; Elliot CE; Chai LY; Pearce LJ; Tipayanon T; Hazell L; Stone S; Piboonpocanun S; Thomas WR; Smith WA Quantitation of IgE binding to the chitinase and chitinase-like house dust mite allergens Der p 15 and Der p 18 compared to the major and mid-range allergens. Int Arch Allergy Immunol. 2013;160(3):233-40
26433526 Thomas WR Hierarchy and molecular properties of house dust mite allergens. Allergol Int. 2015 Oct;64(4):304-11