Allergen

ABF18122.1

Accession ABF18122.1
External DB Link NCBI Protein
Species Aedes aegypti
Common Name yellow fever mosquito
Description unknown function
IUIS Name Aed a 3
Length 273
Year Adopted 2007
Sequence >ABF18122.1 Aed a 3; unknown function [Aedes aegypti]
MKPLVKLFLLFCLVGIVLSRPMPEDEEPVAEGGDDDASGESEGEEETTDDAGGDGGEEEN
EGEEHAGDKDAGGEDTGKEENTGHDDAGEEDAGEEDAGEEDAGEEDAGEEDAEKEEGEKE
DAGDDAGSDDGEEDSTGGDEGEDNAEDSKGSEKNDPADTYRQVVALLDKDTKVDHIQSEY
LRSALNNDLQSEVRVPVVEAIGRIGDYSKIQGCFKSMGKDVKKVISEEEKKFKSCMSKKK
SEYQCSEDSFAAAKSKLSPITSKIKSCVSSKGR
Parent Accession

Related Articles

Pubmed Authors Title Journal
N/A: See Journal Xu,W.; Simons,F.E.R.; Peng,Z. Molecular cloning and characterization of the gene encoding a 30 kDa salivary allergen of mosquito Aedes aegypti Unpublished
14963366 Peng Z; Simons FE Mosquito allergy: immune mechanisms and recombinant salivary allergens. Int Arch Allergy Immunol. 2004 Feb;133(2):198-209
9564803 Peng Z; Li H; Simons FE Immunoblot analysis of salivary allergens in 10 mosquito species with worldwide distribution and the human IgE responses to these allergens. J Allergy Clin Immunol. 1998 Apr;101(4 Pt 1):498-505
17620829 Peng Z; Simons FE Advances in mosquito allergy. Curr Opin Allergy Clin Immunol. 2007 Aug;7(4):350-4
17650501 Calvo E; Tokumasu F; Marinotti O; Villeval JL; Ribeiro JM; Francischetti IM Aegyptin, a novel mosquito salivary gland protein, specifically binds to collagen and prevents its interaction with platelet glycoprotein VI, integrin alpha2beta1, and von Willebrand factor. J Biol Chem. 2007 Sep 14;282(37):26928-38