Allergen

ABG76196.1

Accession ABG76196.1
External DB Link NCBI Protein
Species Dermatophagoides pteronyssinus
Common Name house dust mite
Description NPC2-like
IUIS Name Der p 2
Length 130
Year Adopted 2009
Sequence >ABG76196.1 Der p 2; NPC2-like [Dermatophagoides pteronyssinus]
RDQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEANQNSKTAKIEIKASID
GLEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVMGDNGVLAC
AIATHAKIRD
Parent Accession

Related Articles

Pubmed Authors Title Journal
2021876 Trudinger,M.; Chua,K.Y.; Thomas,W.R. cDNA encoding the major mite allergen Der f II Clin. Exp. Allergy 21 (1), 33-37 (1991)
2341191 Chua,K.Y.; Doyle,C.R.; Simpson,R.J.; Turner,K.J.; Stewart,G.A.; Thomas,W.R. Isolation of cDNA coding for the major mite allergen Der p II by IgE plaque immunoassay Int. Arch. Allergy Appl. Immunol. 91 (2), 118-123 (1990)
11306927 Smith AM; Benjamin DC; Derewenda U; Smith WA; Thomas WR; Chapman MD Sequence polymorphisms and antibody binding to the group 2 dust mite allergens. Int Arch Allergy Immunol. 2001 Jan-Mar;124(1-3):61-3
11398074 Smith AM; Benjamin DC; Hozic N; Derewenda U; Smith WA; Thomas WR; Gafvelin G; van Hage-Hamsten M; Chapman MD The molecular basis of antigenic cross-reactivity between the group 2 mite allergens. J Allergy Clin Immunol. 2001 Jun;107(6):977-84
8508052 Nishiyama C; Yuuki T; Takai T; Okumura Y; Okudaira H Determination of three disulfide bonds in a major house dust mite allergen, Der f II. Int Arch Allergy Immunol. 1993;101(2):159-66
15867862 Erwin EA; Custis NJ; Satinover SM; Perzanowski MS; Woodfolk JA; Crane J; Wickens K; Platts-Mills TA Quantitative measurement of IgE antibodies to purified allergens using streptavidin linked to a high-capacity solid phase. J Allergy Clin Immunol. 2005 May;115(5):1029-35
17505140 Liu,Z.; Bai,Y.; Ji,K.; Liu,X.; Cai,C.; Yu,H.; Li,M.; Bao,Y.; Lian,Y.; Gao,B.; Detection of Dermatophagoides farinae in the Dust of Air Conditioning Filters (er) Int. Arch. Allergy Immunol. 144 (1), 85-90 (2006)
18220991 Thomas WR; Heinrich TK; Smith WA; Hales BJ Pyroglyphid house dust mite allergens. Protein Pept Lett. 2007;14(10):943-53
23481662 An S; Chen L; Long C; Liu X; Xu X; Lu X; Rong M; Liu Z; Lai R Dermatophagoides farinae allergens diversity identification by proteomics. Mol Cell Proteomics. 2013 Jul;12(7):1818-28