Allergen

ABH06352.1

Accession ABH06352.1
External DB Link NCBI Protein
Species Blomia tropicalis
Common Name house dust mite
Description unknown function, group 5/21 mite allergen
IUIS Name Blo t 5
Length 134
Year Adopted 2009
Sequence >ABH06352.1 Blo t 5; unknown function, group 5/21 mite allergen [Blomia tropicalis]
MKFAIVLIACFAASVLAQGHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDEL
NENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKD
LKETEQKVKDIQTQ
Parent Accession

Related Articles

Pubmed Authors Title Journal
8828535 Caraballo,L.; Avjioglu,A.; Marrugo,J.; Puerta,L.; Marsh,D. Cloning and expression of complementary DNA coding for an allergen with common antibody-binding specificities with three allergens of the house dust mite Blomia tropicalis J. Allergy Clin. Immunol. 98 (3), 573-579 (1996)
9001334 Arruda,L.K.; Vailes,L.D.; Platts-Mills,T.A.; Fernandez-Caldas,E.; Montealegre,F.; Lin,K.L.; Chua,K.Y.; Rizzo,M.C.; Naspitz,C.K.; Chapman,M.D. Sensitization to Blomia tropicalis in patients with asthma and identification of allergen Blo t 5 Am. J. Respir. Crit. Care Med. 155 (1), 343-350 (1997)
12580807 Simpson A; Green R; Custovic A; Woodcock A; Arruda LK; Chapman MD Skin test reactivity to natural and recombinant Blomia and Dermatophagoides spp. allergens among mite allergic patients in the UK. Allergy. 2003 Jan;58(1):53-6
17504089 Chua KY; Cheong N; Kuo IC; Lee BW; Yi FC; Huang CH; Liew LN The Blomia tropicalis allergens. Protein Pept Lett. 2007;14(4):325-33
17445876 Gao YF; Wang de Y; Ong TC; Tay SL; Yap KH; Chew FT Identification and characterization of a novel allergen from Blomia tropicalis: Blo t 21. J Allergy Clin Immunol. 2007 Jul;120(1):105-12
18684949 Chan SL; Ong TC; Gao YF; Tiong YS; Wang de Y; Chew FT; Mok YK Nuclear magnetic resonance structure and IgE epitopes of Blo t 5, a major dust mite allergen. J Immunol. 2008 Aug 15;181(4):2586-96