Allergen

ACB46292.1

Accession ACB46292.1
External DB Link NCBI Protein
Species Dermatophagoides pteronyssinus
Common Name house dust mite
Description peritrophin
IUIS Name Der p 23
Length 90
Year Adopted 2014
Sequence >ACB46292.1 Der p 23; peritrophin [Dermatophagoides pteronyssinus]
MKFNIIIVFISLAILVHSSYAANDNDDDPTTTVHPTTTEQPDDKFECPSRFGYFADPKDP
HKFYICSNWEAVHKDCPGNTRWNEDEETCT
Parent Accession

Related Articles

Pubmed Authors Title Journal
23460742 Weghofer,M.; Grote,M.; Resch,Y.; Casset,A.; Kneidinger,M.; Kopec,J.; Thomas,W.R.; Fernandez-Caldas,E.; Kabesch,M.; Ferrara,R.; Mari,A.; Purohit,A.; Pauli,G.; Horak,F.; Keller,W.; Valent,P.; Valenta,R.; Vrtala,S.; Identification of Der p 23, a Peritrophin-like Protein, as a New Major Dermatophagoides pteronyssinus Allergen Associated with the Peritrophic Matrix of Mite Fecal Pellets J. Immunol. 190 (7), 3059-3067 (2013)