Allergen

ACD65081.1

Accession ACD65081.1
External DB Link NCBI Protein
Species Forcipomyia taiwana
Common Name biting midges
Description eukaryotic translation initiation factor
IUIS Name For t 2
Length 325
Year Adopted 2010
Sequence >ACD65081.1 For t 2; eukaryotic translation initiation factor [Forcipomyia taiwana]
MKPLMMQGHERAITQIKYNREGDLLFSCAKDHKPNVWFSLNGERLGTFNGHAGAVWCVDV
DWTTTKLITGSGDMSVRLWDVETGTSVACIPCKSSARTVGFSFSGNQAAYSTDRAMGHIC
ELFVIDSREPDSSLNDGDAILKIPISQSKITAMIWGTLDETIITGHENGQITLWDLRIGR
EINSVNDHMGAINDLQLSKDGTMFVSSSRDTTAKLFDSDSLMCLKTYKTERPVNSAAISP
LLEHVVLGGGQDAMEVTTTSARQGKFDSRFFHLIYEEEFARVKGHFGPINSLAFHPDGRS
YATGGEDGFVRLQTFDSSYYEYIFD
Parent Accession

Related Articles

Pubmed Authors Title Journal
16266384 Chen YH; Lee MF; Lan JL; Chen CS; Wang HL; Hwang GY; Wu CH Hypersensitivity to Forcipomyia taiwana (biting midge): clinical analysis and identification of major For t 1, For t 2 and For t 3 allergens. Allergy. 2005 Dec;60(12):1518-23
19339804 Chen YH; Lee MF; Tsai JJ; Wu HJ; Hwang GY Specific IgE and IgG responses and cytokine profile in subjects with allergic reactions to biting midge Forcipomyia taiwana. Int Arch Allergy Immunol. 2009;150(1):66-74
21470242 Chen YH; Hwang GY; Chen PC; Tu WC; Lee MF Molecular cloning and immunologic characterization of for t 2: a major allergen from the biting midge Forcipomyia taiwana. Allergy. 2011 May;66(5):703-5