Allergen

ACE80959.1

Accession ACE80959.1
External DB Link NCBI Protein
Species Prunus dulcis x Prunus persica
Common Name plant hybrid
Description thaumatin-like
IUIS Name Pru p 2
Length 246
Year Adopted 2010
Sequence >ACE80959.1 Pru p 2; thaumatin-like [Prunus dulcis x Prunus persica]
MMKSQAALLGLTTLAILFFSGAHAAKITFTNKCSYTVWPGTLTGDQKPQLSLTGFKLATG
ISRSVDAPSPWSGRFFGRTRCSTDASGKFTCATADCGSGQVSCNGNGAAPPATLVEITIA
SNGGQDFYDVSLVDGFNLPMSVAPQGGTGKCKASTCPADINKVCPAPLQVKGSDGSVIAC
KSACLAFNQPKYCCTPPNDKPETCPPTDYSKLFKTQCPQAYSYAYDDKSSTFTCSGRPDY
LITFCP
Parent Accession

Related Articles

Pubmed Authors Title Journal
19014629 Chen,L.; Zhang,S.; Illa,E.; Song,L.; Wu,S.; Howad,W.; Arus,P.; van de Weg,E.; Chen,K.; Gao,Z.; Genomic characterization of putative allergen genes in peach/almond and their synteny with apple BMC Genomics 9, 543 (2008)
20701616 Palacín A; Tordesillas L; Gamboa P; Sanchez-Monge R; Cuesta-Herranz J; Sanz ML; Barber D; Salcedo G; Díaz-Perales A Characterization of peach thaumatin-like proteins and their identification as major peach allergens. Clin Exp Allergy. 2010 Sep;40(9):1422-30
N/A: See Journal Das B, Ahmed N, Singh P Prunus diversity-early and present development: a review International Journal of Biodiversity and Conservation 3(14):721-734, 2011
22260748 Costa J; Mafra I; Carrapatoso I; Oliveira MB Almond allergens: molecular characterization, detection, and clinical relevance. J Agric Food Chem. 2012 Feb 15;60(6):1337-49