Allergen

ACR77509.1

Accession ACR77509.1
External DB Link NCBI Protein
Species Chenopodium album
Common Name pigweed
Description profilin
IUIS Name Che a 2
Length 133
Year Adopted 2011
Sequence >ACR77509.1 Che a 2; profilin [Chenopodium album]
MSWQTYVDDHLMFPIEETGNHLTAAAIVGLDGSVWAQSSTFPQLKQEEVKAICNEFDVPN
TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTNQALVFGIYNEPVTPGQCNMV
VEKLGDYLVEQGM
Parent Accession

Related Articles

Pubmed Authors Title Journal
15208604 Barderas,R.; Villalba,M.; Pascual,C.Y.; Batanero,E.; Rodriguez,R. Profilin (Che a 2) and polcalcin (Che a 3) are relevant allergens of Chenopodium album pollen: isolation, amino acid sequences, and immunologic properties J. Allergy Clin. Immunol. 113 (6), 1192-1198 (2004)
15449709 Barderas R; Villalba M; Rodríguez R Recombinant expression, purification and cross-reactivity of chenopod profilin: rChe a 2 as a good marker for profilin sensitization. Biol Chem. 2004 Aug;385(8):731-7