Allergen

ACT37324.1

Accession ACT37324.1
External DB Link NCBI Protein
Species Stachybotrys chartarum
Common Name fungus
Description exodesoxyribonuclease
IUIS Name Sta c 3
Length 144
Year Adopted 2014
Sequence >ACT37324.1 Sta c 3; exodesoxyribonuclease [Stachybotrys chartarum]
ASVTFWTLDNVDRTLVFTGNPGSAAIETITVGPAENTTVEFPGSWVGNWYAYPTDAEDVP
GMLGEVQFGGWNGLTYFDVSAIVNPTDHDNVKQMWPAESRKPMSGCEVFPCDNAYWLPDD
IQTKVTHEVDLWTTLGAGSTGLTF
Parent Accession

Related Articles

Pubmed Authors Title Journal
21109751 Shi,C.; Smith,M.L.; Miller,J.D.; Characterization of human antigenic proteins SchS21 and SchS34 from Stachybotrys chartarum Int. Arch. Allergy Immunol. 155 (1), 74-85 (2011)
22424314 Shi C; Miller JD Sta c 3 epitopes and their application as biomarkers to detect specific IgE. Mol Immunol. 2012 Apr;50(4):271-7
18242638 Xu J; Liang Y; Belisle D; Miller JD Characterization of monoclonal antibodies to an antigenic protein from Stachybotrys chartarum and its measurement in house dust. J Immunol Methods. 2008 Mar 20;332(1-2):121-8