Allergen

ADC80502.1

Accession ADC80502.1
External DB Link NCBI Protein
Species Phaseolus vulgaris
Common Name kidney bean
Description lipid transfer protein
IUIS Name Pha v 3
Length 115
Year Adopted 2011
Sequence >ADC80502.1 Pha v 3; lipid transfer protein [Phaseolus vulgaris]
MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMN
SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASIN
Parent Accession

Related Articles

Pubmed Authors Title Journal
20153058 Zoccatelli,G.; Pokoj,S.; Foetisch,K.; Bartra,J.; Valero,A.; Del Mar San Miguel-Moncin,M.; Vieths,S.; Scheurer,S.; Identification and characterization of the major allergen of green bean (Phaseolus vulgaris) as a non-specific lipid transfer protein (Pha v 3) Mol. Immunol. (2010) In press