Allergen

ADD74392.1

Accession ADD74392.1
External DB Link NCBI Protein
Species Solenopsis saevissima
Common Name Brazilian fire ant
Description unknown function
IUIS Name
Length 137
Year Adopted 2012
Sequence >ADD74392.1 unknown function [Solenopsis saevissima]
MKTFVLVSCLLVFTQIIYALDIKEISIMNRILEKCIRTVPKHENDPINPLRNVNVWYCAF
TKRGIFTPKGVNTKQYINYCEKTAISPADIKLCKKIASKCVKKVYDRPGPIIERSKNLLS
CVLKKGLLELTVYGKKK
Parent Accession

Related Articles

Pubmed Authors Title Journal
8423273 Hoffman,D.R. Allergens in Hymenoptera venom XXIV: the amino acid sequences of imported fire ant venom allergens Sol i II, Sol i III, and Sol i IV J. Allergy Clin. Immunol. 91 (1 Pt 1), 71-78 (1993)
2355158 Hoffman,D.R.; Smith,A.M.; Schmidt,M.; Moffitt,J.E.; Guralnick,M. Allergens in Hymenoptera venom. XXII. Comparison of venoms from two species of imported fire ants, Solenopsis invicta and richteri J. Allergy Clin. Immunol. 85 (6), 988-996 (1990)
9389299 Hoffman,D.R. Reactions to less common species of fire ants J. Allergy Clin. Immunol. 100 (5), 679-683 (1997)
3192865 Hoffman DR; Dove DE; Jacobson RS Allergens in Hymenoptera venom. XX. Isolation of four allergens from imported fire ant (Solenopsis invicta) venom. J Allergy Clin Immunol. 1988 Nov;82(5 Pt 1):818-27
12789229 Caplan EL; Ford JL; Young PF; Ownby DR Fire ants represent an important risk for anaphylaxis among residents of an endemic region. J Allergy Clin Immunol. 2003 Jun;111(6):1274-7